Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C7orf61 Rabbit Polyclonal Antibody (HRP)

C7orf61 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IZ16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004323

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNS Rabbit pAb (APR26909N)
APR26909N-01 50 µL

CTNS Rabbit pAb (APR26909N)

Sign In for Pricing
View Details
CTNS Rabbit pAb (APR26909N)
APR26909N-02 100 µL

CTNS Rabbit pAb (APR26909N)

Sign In for Pricing
View Details
CTNS Rabbit pAb (APR26909N)
APR26909N-03 200 µL

CTNS Rabbit pAb (APR26909N)

Sign In for Pricing
View Details
ASPHD2 Recombinant Protein (Rat)
RP191228 100 µg

ASPHD2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Bovine calcium channel, voltage-dependent, beta 2 subunit ELISA Kit
OM621392 96 Strip Well

Bovine calcium channel, voltage-dependent, beta 2 subunit ELISA Kit

Sign In for Pricing
View Details
PCDH1 Polyclonal Antibody, Cy5.5 Conjugated
bs-11111R-Cy5.5 100 µL

PCDH1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details