Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALE Rabbit Polyclonal Antibody (FITC)

GALE Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SDR1E1

UniProt

Q14376

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GALE

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001008217

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRRS1 3'UTR GFP Stable Cell Line
TU058298 1.0 mL

FRRS1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 1, p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a)
T9161-06G 100 µg

Tumor Necrosis Factor Receptor 1, p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a)

Sign In for Pricing
View Details
Anti-GPR161 Antibody Picoband®, Carrier-free
A10567-1-carrier-free 100 µg/Vial

Anti-GPR161 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
C19orf10/MYDGF Rabbit Polyclonal Antibody (Cy3)
orb2585846 100 µg

C19orf10/MYDGF Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
ABCA2 Antibody, HRP conjugated
MBS7051466-01 0.05 mg

ABCA2 Antibody, HRP conjugated

Sign In for Pricing
View Details
ABCA2 Antibody, HRP conjugated
MBS7051466-02 0.1 mg

ABCA2 Antibody, HRP conjugated

Sign In for Pricing
View Details