Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tagln3 Rabbit Polyclonal Antibody (FITC)

Tagln3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Np, Np25, AI426007, 2700038H05Rik, 2900005O10Rik

UniProt

Q9R1Q8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062728

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-C1orf77/FOP/CHTOP Antibody Picoband®, Carrier-free
A07770-2-carrier-free 100 µg/Vial

Anti-C1orf77/FOP/CHTOP Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Human FOXP4/Forkhead box protein P4 ELISA Kit
MBS2906696-01 48 Well

Human FOXP4/Forkhead box protein P4 ELISA Kit

Sign In for Pricing
View Details
Human FOXP4/Forkhead box protein P4 ELISA Kit
MBS2906696-02 96 Well

Human FOXP4/Forkhead box protein P4 ELISA Kit

Sign In for Pricing
View Details
Human FOXP4/Forkhead box protein P4 ELISA Kit
MBS2906696-03 5x 96 Well

Human FOXP4/Forkhead box protein P4 ELISA Kit

Sign In for Pricing
View Details
Human FOXP4/Forkhead box protein P4 ELISA Kit
MBS2906696-04 10x 96 Well

Human FOXP4/Forkhead box protein P4 ELISA Kit

Sign In for Pricing
View Details
UBE2S Rabbit Polyclonal Antibody (Carrier-free)
orb3108927 100 µg

UBE2S Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details