Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lamtor4 Rabbit Polyclonal Antibody (FITC)

Lamtor4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AV006840, 0910001L09Rik

UniProt

Q8CF66

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074577

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2xSYBR Green qPCR Master Mix (Low ROX)
G3321-05 5 mL

2xSYBR Green qPCR Master Mix (Low ROX)

Sign In for Pricing
View Details
MCL1, ID (Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1, Bcl-2-like Protein 3, Bcl2-L-3, Bcl-2-related Protein EAT/mcl1, mcl1/EAT, BCL2L3, MGC104264, MGC1839)
146046 100 µg

MCL1, ID (Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1, Bcl-2-like Protein 3, Bcl2-L-3, Bcl-2-related Protein EAT/mcl1, mcl1/EAT, BCL2L3, MGC104264, MGC1839)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-Conjugating Enzyme E2I
7-03725 50 µg

Recombinant Human Ubiquitin-Conjugating Enzyme E2I

Sign In for Pricing
View Details
Monkey Lymphotactin ELISA kit
GTR10411040 96 Well

Monkey Lymphotactin ELISA kit

Sign In for Pricing
View Details
Mouse Monoclonal HLA G Antibody (MEM-G/9) [Alexa Fluor 350]
NB500-314AF350 0.1 mL

Mouse Monoclonal HLA G Antibody (MEM-G/9) [Alexa Fluor 350]

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Na(+)/H (+) antiporter subunit C1 (mnhC1)
MBS7020461-01 0.02 mg

Recombinant Staphylococcus aureus Na(+)/H (+) antiporter subunit C1 (mnhC1)

Sign In for Pricing
View Details