Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM83B Rabbit Polyclonal Antibody (HRP)

FAM83B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C6orf143

UniProt

Q5T0W9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FAM83B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001010872

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ier2 3'UTR GFP Stable Cell Line
TU159890 1.0 mL

Ier2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RGD1308114 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
39024066 1.0 µg DNA

RGD1308114 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Jagged1 ELISA Kit PicoKine®
EK2224 96 Well With Removable Strips

Human Jagged1 ELISA Kit PicoKine®

Sign In for Pricing
View Details
Anti-INTS4 Antibody Picoband® Fluoro550 Conjugated
A13277-2-Fluoro550 100 µg/Vial

Anti-INTS4 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
PTGES3, ID (PTGES3, P23, TEBP, Prostaglandin E synthase 3, Cytosolic prostaglandin E2 synthase, Hsp90 co-chaperone, Progesterone receptor complex p23, Telomerase-binding protein p23) (FITC) discontinued
040625-FITC 200 µL

PTGES3, ID (PTGES3, P23, TEBP, Prostaglandin E synthase 3, Cytosolic prostaglandin E2 synthase, Hsp90 co-chaperone, Progesterone receptor complex p23, Telomerase-binding protein p23) (FITC) discontinued

Sign In for Pricing
View Details
Multiplex Assay Kit for Glutathione S Transferase A4 (GSTA4), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026726 96 Tests

Multiplex Assay Kit for Glutathione S Transferase A4 (GSTA4), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details