Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC6L2 Rabbit Polyclonal Antibody (HRP)

ERCC6L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEBO, BMFS2, SR278, RAD26L, C9orf102

UniProt

Q5T890

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD26L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRELATGRKAMQR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TREM-2b Recombinant Protein C-Fc Tag Lyophilized 50UG
IMSTREM2BRCFCLY50UG 50 µg

Mouse TREM-2b Recombinant Protein C-Fc Tag Lyophilized 50UG

Sign In for Pricing
View Details
MCM4 (Minichromosome Maintenance Deficient 4, CDC21, CDC21 Homolog, CDC54, DNA Replication Licensing Factor MCM4, hCdc21, Homolog of S. pombe Cell Devision Cycle 21, MGC33310, Minichromosome Maintenance 4, Minichromosome Maintenance Complex Component 4, P1-CDC21) (PE) discontinued
M2749-32G-PE 100 µL

MCM4 (Minichromosome Maintenance Deficient 4, CDC21, CDC21 Homolog, CDC54, DNA Replication Licensing Factor MCM4, hCdc21, Homolog of S. pombe Cell Devision Cycle 21, MGC33310, Minichromosome Maintenance 4, Minichromosome Maintenance Complex Component 4, P1-CDC21) (PE) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Trnt1 shRNA (UAS) - Lentiviral mouse Trnt1 shRNA (UAS) (100)
GTR15225990 1 Vial

Lentiviral mouse Trnt1 shRNA (UAS) - Lentiviral mouse Trnt1 shRNA (UAS) (100)

Sign In for Pricing
View Details
UGT1A9 Antibody
orb2679085-01 50 µL

UGT1A9 Antibody

Sign In for Pricing
View Details
UGT1A9 Antibody
orb2679085-02 100 µL

UGT1A9 Antibody

Sign In for Pricing
View Details
UGT1A9 Antibody
orb2679085-03 200 µL

UGT1A9 Antibody

Sign In for Pricing
View Details