Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC6L2 Rabbit Polyclonal Antibody (HRP)

ERCC6L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEBO, BMFS2, SR278, RAD26L, C9orf102

UniProt

Q5T890

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ERCC6L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNST

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001010895.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stopcocks, 1:5 Taper, Spare PTFE Keys, Key Bore
2069135/2 1 Each

Stopcocks, 1:5 Taper, Spare PTFE Keys, Key Bore

Sign In for Pricing
View Details
CHRNB4, CT (CHRNB4, Neuronal acetylcholine receptor subunit beta-4) (Biotin)
MBS6285878-01 0.2 mL

CHRNB4, CT (CHRNB4, Neuronal acetylcholine receptor subunit beta-4) (Biotin)

Sign In for Pricing
View Details
CHRNB4, CT (CHRNB4, Neuronal acetylcholine receptor subunit beta-4) (Biotin)
MBS6285878-02 5x 0.2 mL

CHRNB4, CT (CHRNB4, Neuronal acetylcholine receptor subunit beta-4) (Biotin)

Sign In for Pricing
View Details
BRD2, ID (Bromodomain-containing Protein 2, Really Interesting New Gene 3 Protein, O27.1.1, KIAA9001, RING3)
MBS627051-01 0.2 mL

BRD2, ID (Bromodomain-containing Protein 2, Really Interesting New Gene 3 Protein, O27.1.1, KIAA9001, RING3)

Sign In for Pricing
View Details
BRD2, ID (Bromodomain-containing Protein 2, Really Interesting New Gene 3 Protein, O27.1.1, KIAA9001, RING3)
MBS627051-02 5x 0.2 mL

BRD2, ID (Bromodomain-containing Protein 2, Really Interesting New Gene 3 Protein, O27.1.1, KIAA9001, RING3)

Sign In for Pricing
View Details
Allyl 4-Aminopiperdine-1-carboxylate
441200-01 1 g

Allyl 4-Aminopiperdine-1-carboxylate

Sign In for Pricing
View Details