Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C10orf132 Rabbit Polyclonal Antibody (FITC)

C10orf132 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C10orf132, C10orf133, bA459F3.4, bA451M19.3

UniProt

Q2TAP0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf132

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001010917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Calsequestrin 1 Antibody [DyLight 488]
NBP3-00194G 0.1 mL

Rabbit Polyclonal Calsequestrin 1 Antibody [DyLight 488]

Sign In for Pricing
View Details
Klra1 ORF Vector (Rat) (pORF)
ORF069147 1.0 µg DNA

Klra1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Goat Metabotropic Glutamate Receptor 3 (GRM3) ELISA Kit
MBS7258984-01 48 Well

Goat Metabotropic Glutamate Receptor 3 (GRM3) ELISA Kit

Sign In for Pricing
View Details
Goat Metabotropic Glutamate Receptor 3 (GRM3) ELISA Kit
MBS7258984-02 96 Well

Goat Metabotropic Glutamate Receptor 3 (GRM3) ELISA Kit

Sign In for Pricing
View Details
Goat Metabotropic Glutamate Receptor 3 (GRM3) ELISA Kit
MBS7258984-03 5x 96 Well

Goat Metabotropic Glutamate Receptor 3 (GRM3) ELISA Kit

Sign In for Pricing
View Details
Goat Metabotropic Glutamate Receptor 3 (GRM3) ELISA Kit
MBS7258984-04 10x 96 Well

Goat Metabotropic Glutamate Receptor 3 (GRM3) ELISA Kit

Sign In for Pricing
View Details