Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C10orf132 Rabbit Polyclonal Antibody (HRP)

C10orf132 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C10orf132, C10orf133, bA459F3.4, bA451M19.3

UniProt

Q2TAP0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf132

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001010917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD10 Antibody[HI10a]
E-AB-F1141A-01 25 µg

Purified Anti-Human CD10 Antibody[HI10a]

Sign In for Pricing
View Details
Purified Anti-Human CD10 Antibody[HI10a]
E-AB-F1141A-02 100 µg

Purified Anti-Human CD10 Antibody[HI10a]

Sign In for Pricing
View Details
SARS-CoV-2 S1 protein NTD (HV69-70del, Y144del), His Tag (MALS verified)
S1D-C52Hd-100ug 100 µg

SARS-CoV-2 S1 protein NTD (HV69-70del, Y144del), His Tag (MALS verified)

Sign In for Pricing
View Details
CHX10 (VSX2) (NM_182894) Human Recombinant Protein
TP312033L 1 mg

CHX10 (VSX2) (NM_182894) Human Recombinant Protein

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (2F6), CF647 conjugate, 0.1mg/mL
BNC471014-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (2F6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDE4C (NM_001098819) Human Recombinant Protein
TP321103 20 µg

PDE4C (NM_001098819) Human Recombinant Protein

Sign In for Pricing
View Details