Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C10orf132 Rabbit Polyclonal Antibody (HRP)

C10orf132 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C10orf132, C10orf133, bA459F3.4, bA451M19.3

UniProt

Q2TAP0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf132

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001010917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C7 (C7) (Center) Rabbit Polyclonal Antibody
AP50662PU-N 400 µL

Complement C7 (C7) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Propidium iodide *10 mM aqueous solution*
17517-AAT 1 mL

Propidium iodide *10 mM aqueous solution*

Sign In for Pricing
View Details
CD13 (ANPEP) (NM_001150) Human Recombinant Protein
TP308950L 1 mg

CD13 (ANPEP) (NM_001150) Human Recombinant Protein

Sign In for Pricing
View Details
DSEL Human Gene Knockout Kit (CRISPR)
KN421154 1 Kit

DSEL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Csf2rb2 Mouse Gene Knockout Kit (CRISPR)
KN503890 1 Kit

Csf2rb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3145), CF740 conjugate, 0.1mg/mL
BNC743145-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3145), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details