Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKFZp686P1551 Rabbit Polyclonal Antibody (Biotin)

DKFZp686P1551 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BLOM4, EX070, EXO70, EXOC1, 2-5-3p, Exo70p, NEDSEBA, YJL085W

UniProt

Q63HP7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DKFZp686P1551

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BAFF/BLyS/TNFSF13B His-tag Protein CF
11403-BF-050 50 µg

Recombinant Human BAFF/BLyS/TNFSF13B His-tag Protein CF

Sign In for Pricing
View Details
Complement Factor P (CFP) Magnetic Luminex Assay Kit
LKU600633 96 Tests

Complement Factor P (CFP) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
2HX-750-2-OR-2 AB Labels
117416 Roll of 500 Label(s)

2HX-750-2-OR-2 AB Labels

Sign In for Pricing
View Details
Recombinant Drosophila pseudoobscura pseudoobscura Serine/threonine-protein kinase PLK4 (SAK), partial
MBS1437307 Inquire

Recombinant Drosophila pseudoobscura pseudoobscura Serine/threonine-protein kinase PLK4 (SAK), partial

Sign In for Pricing
View Details
NKX28 Antibody
MBS852153-01 0.1 mg

NKX28 Antibody

Sign In for Pricing
View Details
NKX28 Antibody
MBS852153-02 0.1 mL (AF635)

NKX28 Antibody

Sign In for Pricing
View Details