Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFB Rabbit Polyclonal Antibody (HRP)

ETFB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MADD, FP585

UniProt

P38117

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ETFB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001976

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) discontinued
136734 1 mg

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) discontinued

Sign In for Pricing
View Details
REPS2 (POB1, RalBP1-associated Eps Domain-containing Protein 2, Partner of RalBP1, RalBP1-interacting Protein 2)
132476 200 µL

REPS2 (POB1, RalBP1-associated Eps Domain-containing Protein 2, Partner of RalBP1, RalBP1-interacting Protein 2)

Sign In for Pricing
View Details
ITGB2 3'UTR GFP Stable Cell Line
TU061336 1.0 mL

ITGB2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-Human CD73/NT5E (INCA00186)
PTX25443 100 µg

Anti-Human CD73/NT5E (INCA00186)

Sign In for Pricing
View Details
Recombinant Bovine Nuclear transcription factor Y subunit alpha (NFYA)
MBS1459508-01 0.02 mg (E-Coli)

Recombinant Bovine Nuclear transcription factor Y subunit alpha (NFYA)

Sign In for Pricing
View Details
Recombinant Bovine Nuclear transcription factor Y subunit alpha (NFYA)
MBS1459508-02 0.02 mg (Yeast)

Recombinant Bovine Nuclear transcription factor Y subunit alpha (NFYA)

Sign In for Pricing
View Details