Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGBD2 Rabbit Polyclonal Antibody (FITC)

PGBD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

B3KVR8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PGBD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001017434

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Calpain-1 catalytic subunit polyclonal Antibody(CAPN1), Biotin conjugated
MBS1494752-01 0.05 mg

Rabbit anti-human Calpain-1 catalytic subunit polyclonal Antibody(CAPN1), Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Calpain-1 catalytic subunit polyclonal Antibody(CAPN1), Biotin conjugated
MBS1494752-02 0.1 mg

Rabbit anti-human Calpain-1 catalytic subunit polyclonal Antibody(CAPN1), Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Calpain-1 catalytic subunit polyclonal Antibody(CAPN1), Biotin conjugated
MBS1494752-03 5x 0.1 mg

Rabbit anti-human Calpain-1 catalytic subunit polyclonal Antibody(CAPN1), Biotin conjugated

Sign In for Pricing
View Details
Cistanoside H
orb3179754-01 50 mg

Cistanoside H

Sign In for Pricing
View Details
Cistanoside H
orb3179754-02 10 mg

Cistanoside H

Sign In for Pricing
View Details
Lentiviral mouse Nhs shRNA (UAS) - Lentiviral mouse Nhs shRNA (UAS, iRFP) plasmid
GTR15271060 1 Vial

Lentiviral mouse Nhs shRNA (UAS) - Lentiviral mouse Nhs shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details