Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3kbp1 Rabbit Polyclonal Antibody (Biotin)

Sh3kbp1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Seta, CIN85

UniProt

Q6IRL5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Sh3kbp1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTISQVS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_445812

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

No Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW03F-NB 10x 96 Well Plates

No Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1963), CF488A conjugate, 0.1mg/mL
BNC881963-100 1x 100 µL

Tryptase (Mast Cell Marker) (TPSAB1/1963), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VIM) Rabbit Monoclonal Antibody [Clone ID: R01-0E2]
TA421567 100 µL

Vimentin (VIM) Rabbit Monoclonal Antibody [Clone ID: R01-0E2]

Sign In for Pricing
View Details
LRRC72 (NM_001195280) Human Over-expression Lysate
LY434127 100 µg

LRRC72 (NM_001195280) Human Over-expression Lysate

Sign In for Pricing
View Details
AKT2 Mouse Monoclonal Antibody [Clone ID: 1B6]
AM06381SU-N 100 µL

AKT2 Mouse Monoclonal Antibody [Clone ID: 1B6]

Sign In for Pricing
View Details
FGF2 Mouse Monoclonal Antibody [Clone ID: F-74]
AM09159PU-N 500 µg

FGF2 Mouse Monoclonal Antibody [Clone ID: F-74]

Sign In for Pricing
View Details