Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP2 Rabbit Polyclonal Antibody (HRP)

ARFIP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

POR1

UniProt

P53365

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ARFIP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IQ Motif Containing GTPase Activating Protein 2 (IQGAP2) ELISA Kit
RD-IQGAP2-Mu-48Tests 48 Tests

Mouse IQ Motif Containing GTPase Activating Protein 2 (IQGAP2) ELISA Kit

Sign In for Pricing
View Details
RIT1 antibody - middle region
MBS3215341-01 0.1 mL

RIT1 antibody - middle region

Sign In for Pricing
View Details
RIT1 antibody - middle region
MBS3215341-02 5x 0.1 mL

RIT1 antibody - middle region

Sign In for Pricing
View Details
Lrfn3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6149207 1.0 µg DNA

Lrfn3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Equine Interleukin 1 Alpha (IL1a) ELISA Kit
RD-IL1a-Eq-96Tests 96 Tests

Equine Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details
FOXL1 Rabbit Polyclonal Antibody (PE)
orb493458 100 µL

FOXL1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details