Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC7 Rabbit Polyclonal Antibody (Biotin)

CCDC7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BioT2-A, BioT2-B, BioT2-C, RP11-479G22.1

UniProt

Q96M83

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001021554

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR78 Rabbit Polyclonal Antibody (HRP)
orb469517 100 µL

GPR78 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human ALG12 shRNA Plasmid
abx962302-01 150 µg

Human ALG12 shRNA Plasmid

Sign In for Pricing
View Details
Human ALG12 shRNA Plasmid
abx962302-02 300 µg

Human ALG12 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Borrelia recurrentis Probable transcriptional regulatory protein BRE_29 (BRE_29)
MBS1237505-01 0.02 mg (E-Coli)

Recombinant Borrelia recurrentis Probable transcriptional regulatory protein BRE_29 (BRE_29)

Sign In for Pricing
View Details
Recombinant Borrelia recurrentis Probable transcriptional regulatory protein BRE_29 (BRE_29)
MBS1237505-02 0.1 mg (E-Coli)

Recombinant Borrelia recurrentis Probable transcriptional regulatory protein BRE_29 (BRE_29)

Sign In for Pricing
View Details
Recombinant Borrelia recurrentis Probable transcriptional regulatory protein BRE_29 (BRE_29)
MBS1237505-03 0.02 mg (Yeast)

Recombinant Borrelia recurrentis Probable transcriptional regulatory protein BRE_29 (BRE_29)

Sign In for Pricing
View Details