Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D9Ertd402e Rabbit Polyclonal Antibody (Biotin)

D9Ertd402e Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gm1129, TOAG-1, D9Ertd402, D9Ertd402e

UniProt

Q66JZ4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLGSWRAYSEMFCHLRPLRRFGLRKVLPHWLHYSRALSGAEAINALRPFY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013423

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (LN-2), CF740 conjugate, 0.1mg/mL
BNC740056-100 1x 100 µL

CD74 (LN-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
TXNDC (TMX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C1]
TA506945BM 100 µL

TXNDC (TMX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C1]

Sign In for Pricing
View Details
Recombinant YES1 Antibody
RC-6862-01 50 μL

Recombinant YES1 Antibody

Sign In for Pricing
View Details