Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D9Ertd402e Rabbit Polyclonal Antibody (Biotin)

D9Ertd402e Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gm1129, TOAG-1, D9Ertd402, D9Ertd402e

UniProt

Q66JZ4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLGSWRAYSEMFCHLRPLRRFGLRKVLPHWLHYSRALSGAEAINALRPFY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013423

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Golgi Complex (AE-6), CF647 conjugate, 0.1mg/mL
BNC470868-100 1x 100 µL

Golgi Complex (AE-6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Csrp3 (NM_013808) Mouse Tagged ORF Clone
MG201891 10 µg

Csrp3 (NM_013808) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS649188 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
Mouse CD8 alpha Recombinant Rat Monoclonal Antibody
HA610359 100 µL

Mouse CD8 alpha Recombinant Rat Monoclonal Antibody

Sign In for Pricing
View Details
Human TADA3L (TADA3) activation kit by CRISPRa
GA107149 1 Kit

Human TADA3L (TADA3) activation kit by CRISPRa

Sign In for Pricing
View Details