Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D9Ertd402e Rabbit Polyclonal Antibody (FITC)

D9Ertd402e Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gm1129, TOAG-1, D9Ertd402, D9Ertd402e

UniProt

Q66JZ4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLGSWRAYSEMFCHLRPLRRFGLRKVLPHWLHYSRALSGAEAINALRPFY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013423

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Avian Sphingosine 1 Phosphate (S1P) ELISA Kit-Competitive
EK1F669 96 Tests

Avian Sphingosine 1 Phosphate (S1P) ELISA Kit-Competitive

Sign In for Pricing
View Details
UBFD1, NT (UBFD1, UBPH, Ubiquitin domain-containing protein UBFD1, Ubiquitin-binding protein homolog) (MaxLight 750)
MBS6360880-01 0.1 mL

UBFD1, NT (UBFD1, UBPH, Ubiquitin domain-containing protein UBFD1, Ubiquitin-binding protein homolog) (MaxLight 750)

Sign In for Pricing
View Details
UBFD1, NT (UBFD1, UBPH, Ubiquitin domain-containing protein UBFD1, Ubiquitin-binding protein homolog) (MaxLight 750)
MBS6360880-02 5x 0.1 mL

UBFD1, NT (UBFD1, UBPH, Ubiquitin domain-containing protein UBFD1, Ubiquitin-binding protein homolog) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Strc Pre-designed siRNA Set A
SI114006A 1 Each

Mouse Strc Pre-designed siRNA Set A

Sign In for Pricing
View Details
RHOH, CT (RHOH, ARHH, TTF, Rho-related GTP-binding protein RhoH, GTP-binding protein TTF, Translocation three four protein) (MaxLight 650) discontinued
041035-ML650 100 µL

RHOH, CT (RHOH, ARHH, TTF, Rho-related GTP-binding protein RhoH, GTP-binding protein TTF, Translocation three four protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
SIRT1 Rabbit Polyclonal Antibody
orb382038-01 30 µL

SIRT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details