Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEIOC Rabbit Polyclonal Antibody (FITC)

MEIOC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C17orf104

UniProt

A2RUB1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ35848

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028831

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC24A3, NT (SLC24A3, NCKX3, Sodium/potassium/calcium exchanger 3, Na (+) /K (+) /Ca (2+) -exchange protein 3, Solute carrier family 24 member 3) (MaxLight 750) discontinued
041841-ML750 100 µL

SLC24A3, NT (SLC24A3, NCKX3, Sodium/potassium/calcium exchanger 3, Na (+) /K (+) /Ca (2+) -exchange protein 3, Solute carrier family 24 member 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Monkey CD40 ELISA kit
GTR10422818 96 Well

Monkey CD40 ELISA kit

Sign In for Pricing
View Details
TDRD9 CRISPR/Cas9 KO Plasmid (m)
sc-428958 20 µg

TDRD9 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Leptin Antagonist Triple Mutant Mouse Recombinant (Leptin tA Mouse)
PT_41380-01 10 µg

Leptin Antagonist Triple Mutant Mouse Recombinant (Leptin tA Mouse)

Sign In for Pricing
View Details
Leptin Antagonist Triple Mutant Mouse Recombinant (Leptin tA Mouse)
PT_41380-02 50 µg

Leptin Antagonist Triple Mutant Mouse Recombinant (Leptin tA Mouse)

Sign In for Pricing
View Details
Leptin Antagonist Triple Mutant Mouse Recombinant (Leptin tA Mouse)
PT_41380-03 1 mg

Leptin Antagonist Triple Mutant Mouse Recombinant (Leptin tA Mouse)

Sign In for Pricing
View Details