Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IAH1 Rabbit Polyclonal Antibody (HRP)

IAH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IAH1

UniProt

Q2TAA2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IAH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNS

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034702

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSMEM1 Antibody, HRP conjugated
MBS1494004-01 0.05 mg

SSMEM1 Antibody, HRP conjugated

Sign In for Pricing
View Details
SSMEM1 Antibody, HRP conjugated
MBS1494004-02 0.1 mg

SSMEM1 Antibody, HRP conjugated

Sign In for Pricing
View Details
SSMEM1 Antibody, HRP conjugated
MBS1494004-03 5x 0.1 mg

SSMEM1 Antibody, HRP conjugated

Sign In for Pricing
View Details
TNFSF4; OX40L Protein (C-His, Human)
P518910 100 µg

TNFSF4; OX40L Protein (C-His, Human)

Sign In for Pricing
View Details
Lentiviral mouse Cpa1 shRNA (UAS) - Lentiviral mouse Cpa1 shRNA (UAS, RFP) (100)
GTR15170232 1 Vial

Lentiviral mouse Cpa1 shRNA (UAS) - Lentiviral mouse Cpa1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral human MLN shRNA (UAS) - Lentiviral human MLN shRNA (UAS, iRFP) (25)
GTR15149294 1 Vial

Lentiviral human MLN shRNA (UAS) - Lentiviral human MLN shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details