Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCUN1D4 Rabbit Polyclonal Antibody (Biotin)

DCUN1D4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DCNL4

UniProt

Q92564

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DCUN1D4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001035492

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly CONT Antibody, APC Conjugate
DZ41140-APC 200 µL/Vial

Anti-Fruit fly CONT Antibody, APC Conjugate

Sign In for Pricing
View Details
STAP1, NT (F31) (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (MaxLight 490)
MBS6500819-01 0.1 mL

STAP1, NT (F31) (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (MaxLight 490)

Sign In for Pricing
View Details
STAP1, NT (F31) (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (MaxLight 490)
MBS6500819-02 5x 0.1 mL

STAP1, NT (F31) (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (MaxLight 490)

Sign In for Pricing
View Details
APOBEC2 Protein Vector (Human) (pPM-N-D-C-His)
PV322817 500 ng

APOBEC2 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
ARG1/Arginase 1 Antibody
orb1538409 50 μL

ARG1/Arginase 1 Antibody

Sign In for Pricing
View Details
Olfr136 3'UTR GFP Stable Cell Line
TU164863 1.0 mL

Olfr136 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details