Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAK1 Rabbit Polyclonal Antibody (FITC)

TRAK1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DEE68, MILT1, EIEE68, OIP106

UniProt

Q9UPV9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRAK1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IYGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001036111

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Gephyrin [Includes: Molybdopterin adenylyltransferase (GPHN) ELISA Kit
MBS287625-01 48 Tests

Chicken Gephyrin [Includes: Molybdopterin adenylyltransferase (GPHN) ELISA Kit

Sign In for Pricing
View Details
Chicken Gephyrin [Includes: Molybdopterin adenylyltransferase (GPHN) ELISA Kit
MBS287625-02 96 Tests

Chicken Gephyrin [Includes: Molybdopterin adenylyltransferase (GPHN) ELISA Kit

Sign In for Pricing
View Details
Chicken Gephyrin [Includes: Molybdopterin adenylyltransferase (GPHN) ELISA Kit
MBS287625-03 5x 96 Tests

Chicken Gephyrin [Includes: Molybdopterin adenylyltransferase (GPHN) ELISA Kit

Sign In for Pricing
View Details
Chicken Gephyrin [Includes: Molybdopterin adenylyltransferase (GPHN) ELISA Kit
MBS287625-04 10x 96 Tests

Chicken Gephyrin [Includes: Molybdopterin adenylyltransferase (GPHN) ELISA Kit

Sign In for Pricing
View Details
MAL2 (NM_052886) Human Tagged Lenti ORF Clone
RC203862L4 10 µg

MAL2 (NM_052886) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Prolactin-releasing peptide, PRLH ELISA KIT
ELI-22362h 96 Tests

Human Prolactin-releasing peptide, PRLH ELISA KIT

Sign In for Pricing
View Details