Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGR Rabbit Polyclonal Antibody (HRP)

FGR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRC2, c-fgr, c-src2, p55-Fgr, p58-Fgr, p55c-fgr, p58c-fgr

UniProt

P09769

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FGR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001036194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mesenchymal Stromal Cell Marker Antibody Sampler Kit
HAK21045 1 Kit

Mesenchymal Stromal Cell Marker Antibody Sampler Kit

Sign In for Pricing
View Details
Nitrate Ionophore VI
TRC-H457520-100MG 100 mg

Nitrate Ionophore VI

Sign In for Pricing
View Details
Cardiac Troponin T (TNNT2) (NM_001001430) Human Over-expression Lysate
LC424349 20 µg

Cardiac Troponin T (TNNT2) (NM_001001430) Human Over-expression Lysate

Sign In for Pricing
View Details
Casein Kinase II α (Ab-255) Antibody
8B1192-AAT 50 µg

Casein Kinase II α (Ab-255) Antibody

Sign In for Pricing
View Details
4-Mercaptocinnamic Acid
TRC-M252650-1G 1 g

4-Mercaptocinnamic Acid

Sign In for Pricing
View Details
CD44v3 (Marker of Tumor Metastasis) (3G5), 0.2mg/mL
BNUB2429-100 1x 100 µL

CD44v3 (Marker of Tumor Metastasis) (3G5), 0.2mg/mL

Sign In for Pricing
View Details