Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGR Rabbit Polyclonal Antibody (HRP)

FGR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRC2, c-fgr, c-src2, p55-Fgr, p58-Fgr, p55c-fgr, p58c-fgr

UniProt

P09769

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FGR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001036194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MORC3 (NM_015358) Human Recombinant Protein
TP310530L 1 mg

MORC3 (NM_015358) Human Recombinant Protein

Sign In for Pricing
View Details
PIK3C2B Human Gene Knockout Kit (CRISPR)
KN418354 1 Kit

PIK3C2B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PDZRN4 activation kit by CRISPRa
GA109336 1 Kit

Human PDZRN4 activation kit by CRISPRa

Sign In for Pricing
View Details
PKC alpha (PRKCA) Mouse Monoclonal Antibody [Clone ID: OTI3D2]
CF813397 100 µg

PKC alpha (PRKCA) Mouse Monoclonal Antibody [Clone ID: OTI3D2]

Sign In for Pricing
View Details
PICK1 (N-term) Rabbit Polyclonal Antibody
AP13655PU-N 400 µL

PICK1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), 0.2mg/mL
BNUB2428-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), 0.2mg/mL

Sign In for Pricing
View Details