Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARSA Rabbit Polyclonal Antibody (Biotin)

ARSA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ASA, MLD

UniProt

P15289

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARSA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001078896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF139 (E3 Ubiquitin-Protein Ligase RNF139, 632-, RING Finger Protein 139, Translocation in renal Carcinoma on Chromosome 8 Protein, RNF139) (MaxLight 490)
MBS6458819-01 0.1 mL

RNF139 (E3 Ubiquitin-Protein Ligase RNF139, 632-, RING Finger Protein 139, Translocation in renal Carcinoma on Chromosome 8 Protein, RNF139) (MaxLight 490)

Sign In for Pricing
View Details
RNF139 (E3 Ubiquitin-Protein Ligase RNF139, 632-, RING Finger Protein 139, Translocation in renal Carcinoma on Chromosome 8 Protein, RNF139) (MaxLight 490)
MBS6458819-02 5x 0.1 mL

RNF139 (E3 Ubiquitin-Protein Ligase RNF139, 632-, RING Finger Protein 139, Translocation in renal Carcinoma on Chromosome 8 Protein, RNF139) (MaxLight 490)

Sign In for Pricing
View Details
Human One cut domain family member 2 (ONECUT2) ELISA Kit
orb1669131-01 48 Tests

Human One cut domain family member 2 (ONECUT2) ELISA Kit

Sign In for Pricing
View Details
Human One cut domain family member 2 (ONECUT2) ELISA Kit
orb1669131-02 96 Tests

Human One cut domain family member 2 (ONECUT2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Aspergillus niger U3 small nucleolar RNA-associated protein 25 (utp25), partial
MBS1111902 Inquire

Recombinant Aspergillus niger U3 small nucleolar RNA-associated protein 25 (utp25), partial

Sign In for Pricing
View Details
Recombinant Rhomboid protease glpG (glpG)
MBS7015855-01 0.02 mg

Recombinant Rhomboid protease glpG (glpG)

Sign In for Pricing
View Details