Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4933434E20Rik Rabbit Polyclonal Antibody (HRP)

4933434E20Rik Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NICE-3, NS5ATP4, AI462154, 5730552F22Rik

UniProt

Q8R092

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080038

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPE-retinal G protein-coupled receptor (RGR) Antibody
abx323179-01 50 µg

RPE-retinal G protein-coupled receptor (RGR) Antibody

Sign In for Pricing
View Details
RPE-retinal G protein-coupled receptor (RGR) Antibody
abx323179-02 100 µg

RPE-retinal G protein-coupled receptor (RGR) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RHAMM/CD168 Antibody [DyLight 594]
NBP1-76538DL594 0.1 mL

Rabbit Polyclonal RHAMM/CD168 Antibody [DyLight 594]

Sign In for Pricing
View Details
Dog Complement Component 5a (C5a) Peptide
abx660041-01 50 µg

Dog Complement Component 5a (C5a) Peptide

Sign In for Pricing
View Details
Dog Complement Component 5a (C5a) Peptide
abx660041-02 100 µg

Dog Complement Component 5a (C5a) Peptide

Sign In for Pricing
View Details
Dog Complement Component 5a (C5a) Peptide
abx660041-03 200 µg

Dog Complement Component 5a (C5a) Peptide

Sign In for Pricing
View Details