Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOHLH1 Rabbit Polyclonal Antibody (HRP)

SOHLH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ODG5, TEB2, NOHLH, SPGF32, SPATA27, bHLHe80, C9orf157, bA100C15.3

UniProt

Q5JUK2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SOHLH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001095147

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP27A1 (Sterol 26-hydroxylase, Mitochondrial, Cytochrome P450 27, Cytochrome P-450C27/25, Sterol 27-hydroxylase, Vitamin D(3) 25-hydroxylase, 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase, CYP27) (Biotin)
MBS6375404-01 0.1 mL

CYP27A1 (Sterol 26-hydroxylase, Mitochondrial, Cytochrome P450 27, Cytochrome P-450C27/25, Sterol 27-hydroxylase, Vitamin D(3) 25-hydroxylase, 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase, CYP27) (Biotin)

Sign In for Pricing
View Details
CYP27A1 (Sterol 26-hydroxylase, Mitochondrial, Cytochrome P450 27, Cytochrome P-450C27/25, Sterol 27-hydroxylase, Vitamin D(3) 25-hydroxylase, 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase, CYP27) (Biotin)
MBS6375404-02 5x 0.1 mL

CYP27A1 (Sterol 26-hydroxylase, Mitochondrial, Cytochrome P450 27, Cytochrome P-450C27/25, Sterol 27-hydroxylase, Vitamin D(3) 25-hydroxylase, 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase, CYP27) (Biotin)

Sign In for Pricing
View Details
Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 10 (ADAMTS10) ELISA Kit
MBS7241808-01 48 Well

Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 10 (ADAMTS10) ELISA Kit

Sign In for Pricing
View Details
Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 10 (ADAMTS10) ELISA Kit
MBS7241808-02 96 Well

Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 10 (ADAMTS10) ELISA Kit

Sign In for Pricing
View Details
Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 10 (ADAMTS10) ELISA Kit
MBS7241808-03 5x 96 Well

Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 10 (ADAMTS10) ELISA Kit

Sign In for Pricing
View Details
Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 10 (ADAMTS10) ELISA Kit
MBS7241808-04 10x 96 Well

Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 10 (ADAMTS10) ELISA Kit

Sign In for Pricing
View Details