Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARG2 Rabbit Polyclonal Antibody (Biotin)

ARG2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P78540

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARG2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT13 (Keratin, Type I Cytoskeletal 13, Cytokeratin-13, CK-13, Keratin-13, K13, MGC161462, MGC3781) (MaxLight 650)
MBS6222927-01 0.1 mL

KRT13 (Keratin, Type I Cytoskeletal 13, Cytokeratin-13, CK-13, Keratin-13, K13, MGC161462, MGC3781) (MaxLight 650)

Sign In for Pricing
View Details
KRT13 (Keratin, Type I Cytoskeletal 13, Cytokeratin-13, CK-13, Keratin-13, K13, MGC161462, MGC3781) (MaxLight 650)
MBS6222927-02 5x 0.1 mL

KRT13 (Keratin, Type I Cytoskeletal 13, Cytokeratin-13, CK-13, Keratin-13, K13, MGC161462, MGC3781) (MaxLight 650)

Sign In for Pricing
View Details
Rat Sh3bgrl1 Pre-designed siRNA Set A
SI212786A 1 Each

Rat Sh3bgrl1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PRC1 Antibody
orb750435 2 mL

PRC1 Antibody

Sign In for Pricing
View Details
hsa-miR-3914 miRNA Mimic
MBS8299229-01 5 nmol

hsa-miR-3914 miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-3914 miRNA Mimic
MBS8299229-02 10 nmol

hsa-miR-3914 miRNA Mimic

Sign In for Pricing
View Details