Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARG2 Rabbit Polyclonal Antibody (FITC)

ARG2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P78540

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ARG2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osteocalcin, CT (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (AP)
MBS6491200-01 0.2 mL

Osteocalcin, CT (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (AP)

Sign In for Pricing
View Details
Osteocalcin, CT (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (AP)
MBS6491200-02 5x 0.2 mL

Osteocalcin, CT (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (AP)

Sign In for Pricing
View Details
Phospho-HCLS1 (Tyr397) Antibody
CSB-PA258754 100 µL

Phospho-HCLS1 (Tyr397) Antibody

Sign In for Pricing
View Details
Feline IgG2, kappa Isotype Control antibody (HyHEL-10)
ARO-A20131 100 µg

Feline IgG2, kappa Isotype Control antibody (HyHEL-10)

Sign In for Pricing
View Details
Monoclonal Antibody to Tyrosine Kinase 2 (Tyk2)
TRV-0059237-01 20 µL

Monoclonal Antibody to Tyrosine Kinase 2 (Tyk2)

Sign In for Pricing
View Details
Monoclonal Antibody to Tyrosine Kinase 2 (Tyk2)
TRV-0059237-02 100 µL

Monoclonal Antibody to Tyrosine Kinase 2 (Tyk2)

Sign In for Pricing
View Details