Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB41L2 Rabbit Polyclonal Antibody (HRP)

EPB41L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

4.1G, 4.1-G

UniProt

O43491

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EPB41L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

EAW48065

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GROS1 (Growth Suppressor 1, Leucine-and Proline-enriched Proteoglycan 1, LEPRE1, Leprecan-1, MGC117314, OI8, Prolyl 3-hydroxylase 1, P3H1, PSEC0109) (PE)
MBS6380285-01 0.1 mL

GROS1 (Growth Suppressor 1, Leucine-and Proline-enriched Proteoglycan 1, LEPRE1, Leprecan-1, MGC117314, OI8, Prolyl 3-hydroxylase 1, P3H1, PSEC0109) (PE)

Sign In for Pricing
View Details
GROS1 (Growth Suppressor 1, Leucine-and Proline-enriched Proteoglycan 1, LEPRE1, Leprecan-1, MGC117314, OI8, Prolyl 3-hydroxylase 1, P3H1, PSEC0109) (PE)
MBS6380285-02 5x 0.1 mL

GROS1 (Growth Suppressor 1, Leucine-and Proline-enriched Proteoglycan 1, LEPRE1, Leprecan-1, MGC117314, OI8, Prolyl 3-hydroxylase 1, P3H1, PSEC0109) (PE)

Sign In for Pricing
View Details
CCR6 Antibody, Biotin conjugated
CSB-PA004845ED01HU-01 50 µg

CCR6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CCR6 Antibody, Biotin conjugated
CSB-PA004845ED01HU-02 100 µg

CCR6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-ALPI Antibody (R3B81)
RHC44401 100 μg

Anti-ALPI Antibody (R3B81)

Sign In for Pricing
View Details
Ras (MaxLight 405) discontinued
R1198-05A-ML405 100 µL

Ras (MaxLight 405) discontinued

Sign In for Pricing
View Details