Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL58 Rabbit Polyclonal Antibody (Biotin)

MRPL58 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DS1, DS-1, ICT1, MRP-L58

UniProt

Q14197

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ICT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-17B (aa77-89) Immunizing Peptide
orb737906 100 µg

IL-17B (aa77-89) Immunizing Peptide

Sign In for Pricing
View Details
Anti M13 G8P-FITC mouse monoclonal antibody
MBS157823-01 0.1 mg

Anti M13 G8P-FITC mouse monoclonal antibody

Sign In for Pricing
View Details
Anti M13 G8P-FITC mouse monoclonal antibody
MBS157823-02 5x 0.1 mg

Anti M13 G8P-FITC mouse monoclonal antibody

Sign In for Pricing
View Details
FLT3, NT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (AP)
MBS6476640-01 0.2 mL

FLT3, NT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (AP)

Sign In for Pricing
View Details
FLT3, NT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (AP)
MBS6476640-02 5x 0.2 mL

FLT3, NT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (AP)

Sign In for Pricing
View Details
mmu-miR-6938-3p miRNA Antagomir
MBS8319873-01 10 nmol

mmu-miR-6938-3p miRNA Antagomir

Sign In for Pricing
View Details