Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL58 Rabbit Polyclonal Antibody (FITC)

MRPL58 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DS1, DS-1, ICT1, MRP-L58

UniProt

Q14197

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ICT1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Barbarea verna NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic
MBS7023092-01 0.02 mg

Recombinant Barbarea verna NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

Sign In for Pricing
View Details
Recombinant Barbarea verna NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic
MBS7023092-02 0.1 mg

Recombinant Barbarea verna NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

Sign In for Pricing
View Details
Recombinant Barbarea verna NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic
MBS7023092-03 5x 0.1 mg

Recombinant Barbarea verna NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C713.13 (SPBC713.13)
orb2934210-01 20 µg

Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C713.13 (SPBC713.13)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C713.13 (SPBC713.13)
orb2934210-02 100 µg

Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C713.13 (SPBC713.13)

Sign In for Pricing
View Details
Cca Antibody
orb811145 2 mg

Cca Antibody

Sign In for Pricing
View Details