Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFRD1 Rabbit Polyclonal Antibody (Biotin)

IFRD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PC4, TIS7

UniProt

O00458

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IFRD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTKN Protein Vector (Mouse) (pPM-C-HA)
42862024 500 ng

RTKN Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
AIMP2 Rabbit Polyclonal Antibody
orb584307 100 µL

AIMP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GSTA5 Rabbit Polyclonal Antibody (BF555)
orb2500810 100 µL

GSTA5 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
NR4A2, NT (Nuclear Receptor Subfamily 4 Group A Member 2, Orphan Nuclear Receptor NURR1, NURR1, TINUR, NURR1, Immediate-early Response Protein NOT, NOT, Transcriptionally Inducible Nuclear Receptor) (PE)
MBS6490704-01 0.2 mL

NR4A2, NT (Nuclear Receptor Subfamily 4 Group A Member 2, Orphan Nuclear Receptor NURR1, NURR1, TINUR, NURR1, Immediate-early Response Protein NOT, NOT, Transcriptionally Inducible Nuclear Receptor) (PE)

Sign In for Pricing
View Details
NR4A2, NT (Nuclear Receptor Subfamily 4 Group A Member 2, Orphan Nuclear Receptor NURR1, NURR1, TINUR, NURR1, Immediate-early Response Protein NOT, NOT, Transcriptionally Inducible Nuclear Receptor) (PE)
MBS6490704-02 5x 0.2 mL

NR4A2, NT (Nuclear Receptor Subfamily 4 Group A Member 2, Orphan Nuclear Receptor NURR1, NURR1, TINUR, NURR1, Immediate-early Response Protein NOT, NOT, Transcriptionally Inducible Nuclear Receptor) (PE)

Sign In for Pricing
View Details
PYK2, phosphorylated (Tyr579)
331529 100 µL

PYK2, phosphorylated (Tyr579)

Sign In for Pricing
View Details