Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB8, Human (His)

The HSPB8 protein exhibits temperature-dependent chaperone activity and functions as a monomer in its molecular form.It interacts with other cellular proteins to form complexes critical for cellular homeostasis.HSPB8 Protein, Human (His) is the recombinant human-derived HSPB8 protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HSPB8 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hspb8-protein-human-his.html

Purity

95.25

Smiles

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

Molecular Formula

26353 (Gene_ID) Q9UJY1 (M1-T196) (Accession)

Molecular Weight

Approximately 23.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSK2 (F-2) PE
sc-377151 PE 200 µg/mL

MSK2 (F-2) PE

Sign In for Pricing
View Details
Recombinant B7-H3 Protein (Gly 27-Thr 461)
VAng-1085Lsx-1mg 1 mg

Recombinant B7-H3 Protein (Gly 27-Thr 461)

Sign In for Pricing
View Details
IFNA4 (NM_021068) Human Recombinant Protein
TP323649M 100 µg

IFNA4 (NM_021068) Human Recombinant Protein

Sign In for Pricing
View Details
Guan-fu base G
MBS5761041 Inquire

Guan-fu base G

Sign In for Pricing
View Details
Rabbit Polyclonal OSTM1 Antibody [Alexa Fluor 405]
NBP2-99663AF405 0.1 mL

Rabbit Polyclonal OSTM1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Avian hepatitis E virus Non-structural polyprotein pORF1 (ORF1), partial
MBS1400245 Inquire

Recombinant Avian hepatitis E virus Non-structural polyprotein pORF1 (ORF1), partial

Sign In for Pricing
View Details