Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB8, Human (His)

The HSPB8 protein exhibits temperature-dependent chaperone activity and functions as a monomer in its molecular form.It interacts with other cellular proteins to form complexes critical for cellular homeostasis.HSPB8 Protein, Human (His) is the recombinant human-derived HSPB8 protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HSPB8 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hspb8-protein-human-his.html

Purity

95.25

Smiles

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

Molecular Formula

26353 (Gene_ID) Q9UJY1 (M1-T196) (Accession)

Molecular Weight

Approximately 23.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITI-H3 (m) : 293T Lysate
sc-121133 100 µg - 200 µL

ITI-H3 (m) : 293T Lysate

Sign In for Pricing
View Details
Lentiviral mouse Ccdc116 shRNA (UAS) - Lentiviral mouse Ccdc116 shRNA (UAS, RFP) plasmid
GTR15131749 1 Vial

Lentiviral mouse Ccdc116 shRNA (UAS) - Lentiviral mouse Ccdc116 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
GRXCR1 Protein Lysate (Rat) with C-HA Tag
22717036 100 µg

GRXCR1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Isovitexin 10mM * 1mL in DMSO
A12079-10mM-D 10 mM x 1mL in DMSO

Isovitexin 10mM * 1mL in DMSO

Sign In for Pricing
View Details
IGHV3OR15-7 Recombinant Protein (Human)
RP064656 100 µg

IGHV3OR15-7 Recombinant Protein (Human)

Sign In for Pricing
View Details
Neurofibromin 1 Antibody [J9P10]
C20510-20uL 20 µL

Neurofibromin 1 Antibody [J9P10]

Sign In for Pricing
View Details