Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB8, Human (His)

The HSPB8 protein exhibits temperature-dependent chaperone activity and functions as a monomer in its molecular form.It interacts with other cellular proteins to form complexes critical for cellular homeostasis.HSPB8 Protein, Human (His) is the recombinant human-derived HSPB8 protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HSPB8 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hspb8-protein-human-his.html

Purity

95.25

Smiles

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

Molecular Formula

26353 (Gene_ID) Q9UJY1 (M1-T196) (Accession)

Molecular Weight

Approximately 23.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (2-Bromo-4-fluorophenoxymethyl) quinoline
SRB65658-01 250 mg

2- (2-Bromo-4-fluorophenoxymethyl) quinoline

Sign In for Pricing
View Details
2- (2-Bromo-4-fluorophenoxymethyl) quinoline
SRB65658-02 2.5 g

2- (2-Bromo-4-fluorophenoxymethyl) quinoline

Sign In for Pricing
View Details
Lrrc56 (NM_001024902) Rat Tagged Lenti ORF Clone
RR201202L3 10 µg

Lrrc56 (NM_001024902) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DARC Protein Vector (Human) (pPM-C-HA)
PV011667 500 ng

DARC Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human ROGDI protein
orb1292056-01 50 µg

Human ROGDI protein

Sign In for Pricing
View Details
Human ROGDI protein
orb1292056-02 100 µg

Human ROGDI protein

Sign In for Pricing
View Details