Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP3 Rabbit Polyclonal Antibody (FITC)

FKBP3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FKBP-3, FKBP25, PPIase, FKBP-25

UniProt

Q00688

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002004

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cholinergic Receptor, Muscarinic 2 (CHRM2) ELISA Kit
RDR-CHRM2-Mu-96Tests 96 Tests

Mouse Cholinergic Receptor, Muscarinic 2 (CHRM2) ELISA Kit

Sign In for Pricing
View Details
ZFAND5 Rabbit pAb, Pacific Blue conjugated
orb2881481 100 µL

ZFAND5 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
ANKRD50 Double Nickase Plasmid (h)
sc-412772-NIC 20 µg

ANKRD50 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
DUOXA1 Antibody - C-terminal region : Biotin (ARP61204_P050-Biotin)
ARP61204_P050-Biotin 100 µL

DUOXA1 Antibody - C-terminal region : Biotin (ARP61204_P050-Biotin)

Sign In for Pricing
View Details
STAP1 Recombinant Protein (Rat)
RP231320 100 µg

STAP1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF594 conjugate, 0.1mg/mL
BNC941731-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details