Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP3 Rabbit Polyclonal Antibody (HRP)

FKBP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FKBP-3, FKBP25, PPIase, FKBP-25

UniProt

Q00688

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002004

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

16S V4-V5 Library Preparation Kit for Illumina (Set C)
70730 96 Preparations

16S V4-V5 Library Preparation Kit for Illumina (Set C)

Sign In for Pricing
View Details
AQP1 Antibody
8C14546-AAT 50 µg

AQP1 Antibody

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF740 conjugate, 0.1mg/mL
BNC741986-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Cnga1 activation kit by CRISPRa
GA200783 1 Kit

Mouse Cnga1 activation kit by CRISPRa

Sign In for Pricing
View Details
tert-Butyl 2-Oxo-7-azaspiro[3.5]nonane-7-carboxylate
TRC-B809638-500MG 500 mg

tert-Butyl 2-Oxo-7-azaspiro[3.5]nonane-7-carboxylate

Sign In for Pricing
View Details
Folate Receptor 4 (IZUMO1R) (NM_001080486) Human Over-expression Lysate
LY421041 100 µg

Folate Receptor 4 (IZUMO1R) (NM_001080486) Human Over-expression Lysate

Sign In for Pricing
View Details