Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI1 Rabbit Polyclonal Antibody (Biotin)

GNAI1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gi

UniProt

P63096

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GNAI1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002060

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUVBL2 (RuvB-like 2, RVB2, TIH2, ECP51, TIP48, CGI-46, INO80J, Reptin, TIP49B) (MaxLight 650)
MBS6436503-01 0.1 mL

RUVBL2 (RuvB-like 2, RVB2, TIH2, ECP51, TIP48, CGI-46, INO80J, Reptin, TIP49B) (MaxLight 650)

Sign In for Pricing
View Details
RUVBL2 (RuvB-like 2, RVB2, TIH2, ECP51, TIP48, CGI-46, INO80J, Reptin, TIP49B) (MaxLight 650)
MBS6436503-02 5x 0.1 mL

RUVBL2 (RuvB-like 2, RVB2, TIH2, ECP51, TIP48, CGI-46, INO80J, Reptin, TIP49B) (MaxLight 650)

Sign In for Pricing
View Details
Keratin (Type I cuticular Ha5 (KRT35) Mouse ELISA Kit
E4963 96 Tests

Keratin (Type I cuticular Ha5 (KRT35) Mouse ELISA Kit

Sign In for Pricing
View Details
Ikzf4 Mouse shRNA Plasmid (Locus ID 22781)
TL514337 1 Kit

Ikzf4 Mouse shRNA Plasmid (Locus ID 22781)

Sign In for Pricing
View Details
Mouse Slit Homolog 1 (Slit1) ELISA Kit
MBS2705069-01 24 Strip Well

Mouse Slit Homolog 1 (Slit1) ELISA Kit

Sign In for Pricing
View Details
Mouse Slit Homolog 1 (Slit1) ELISA Kit
MBS2705069-02 48 Well

Mouse Slit Homolog 1 (Slit1) ELISA Kit

Sign In for Pricing
View Details