Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnaq Rabbit Polyclonal Antibody (FITC)

Gnaq Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Galphaq

UniProt

P82471

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112298

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heatr3 (NM_172757) Mouse Tagged ORF Clone Lentiviral Particle
MR209985L4V 200 µL

Heatr3 (NM_172757) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Oosp3 (NM_001033283) Mouse Tagged ORF Clone Lentiviral Particle
MR212726L3V 200 µL

Oosp3 (NM_001033283) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Progressive ankylosis protein homolog, ANKH ELISA Kit
MBS9338028-01 48 Well

Rat Progressive ankylosis protein homolog, ANKH ELISA Kit

Sign In for Pricing
View Details
Rat Progressive ankylosis protein homolog, ANKH ELISA Kit
MBS9338028-02 96 Well

Rat Progressive ankylosis protein homolog, ANKH ELISA Kit

Sign In for Pricing
View Details
Rat Progressive ankylosis protein homolog, ANKH ELISA Kit
MBS9338028-03 5x 96 Well

Rat Progressive ankylosis protein homolog, ANKH ELISA Kit

Sign In for Pricing
View Details
Rat Progressive ankylosis protein homolog, ANKH ELISA Kit
MBS9338028-04 10x 96 Well

Rat Progressive ankylosis protein homolog, ANKH ELISA Kit

Sign In for Pricing
View Details