Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA5 Rabbit Polyclonal Antibody (HRP)

IFNA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INA5, INFA5, leIF G, IFN-alphaG, IFN-alpha-5

UniProt

P01569

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IFNA5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_002160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubap1 Rat shRNA Plasmid (Locus ID 362502)
TR701696 1 Kit

Ubap1 Rat shRNA Plasmid (Locus ID 362502)

Sign In for Pricing
View Details
SLC19A3 Polyclonal Antibody FITC Conjugated
C92718FITC 100 µL

SLC19A3 Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details
RNF144B Protein Vector (Mouse) (pPB-C-His)
PV224674 500 ng

RNF144B Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Olr1250 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV637741 1.0 µg DNA

Olr1250 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse IgG1 Isotype Control APC Antibody
orb154438 0.1 mg

Mouse IgG1 Isotype Control APC Antibody

Sign In for Pricing
View Details
DGCR7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV723076 1.0 µg DNA

DGCR7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details