Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP1 Rabbit Polyclonal Antibody (Biotin)

INPP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P49441

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human INPP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDST

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_006712561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIFC3 Polyclonal Antibody
MBS9129085-01 0.02 mL

KIFC3 Polyclonal Antibody

Sign In for Pricing
View Details
KIFC3 Polyclonal Antibody
MBS9129085-02 0.1 mL

KIFC3 Polyclonal Antibody

Sign In for Pricing
View Details
KIFC3 Polyclonal Antibody
MBS9129085-03 5x 0.1 mL

KIFC3 Polyclonal Antibody

Sign In for Pricing
View Details
TAL1 (T90) (T-cell Acute Lymphocytic Leukemia Protein 1, TAL-1, Stem Cell Protein, T-cell Leukemia/Lymphoma Protein 5, Class A Basic Helix-loop-helix Protein 17, bHLHa17, SCL, TCL5) (PE)
MBS6502073-01 0.2 mL

TAL1 (T90) (T-cell Acute Lymphocytic Leukemia Protein 1, TAL-1, Stem Cell Protein, T-cell Leukemia/Lymphoma Protein 5, Class A Basic Helix-loop-helix Protein 17, bHLHa17, SCL, TCL5) (PE)

Sign In for Pricing
View Details
TAL1 (T90) (T-cell Acute Lymphocytic Leukemia Protein 1, TAL-1, Stem Cell Protein, T-cell Leukemia/Lymphoma Protein 5, Class A Basic Helix-loop-helix Protein 17, bHLHa17, SCL, TCL5) (PE)
MBS6502073-02 5x 0.2 mL

TAL1 (T90) (T-cell Acute Lymphocytic Leukemia Protein 1, TAL-1, Stem Cell Protein, T-cell Leukemia/Lymphoma Protein 5, Class A Basic Helix-loop-helix Protein 17, bHLHa17, SCL, TCL5) (PE)

Sign In for Pricing
View Details
CD20 Antibody
orb1805694-01 100 µg

CD20 Antibody

Sign In for Pricing
View Details