Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpsa Rabbit Polyclonal Antibody (HRP)

Rpsa Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L, La, MLR, P40, 67lr, Lamr, P40-, 67kDa, Lamr1, P40-3, P40-8, Lamrl1, AL022858

UniProt

P14206

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5D, ID (UNC5D, KIAA1777, UNC5H4, Netrin receptor UNC5D, Protein unc-5 homolog 4, Protein unc-5 homolog D) (MaxLight 490) discontinued
043615-ML490 100 µL

UNC5D, ID (UNC5D, KIAA1777, UNC5H4, Netrin receptor UNC5D, Protein unc-5 homolog 4, Protein unc-5 homolog D) (MaxLight 490) discontinued

Sign In for Pricing
View Details
HMGA1 Peptide - N-terminal region
orb2002594 100 µg

HMGA1 Peptide - N-terminal region

Sign In for Pricing
View Details
KIN siRNA (Human)
CRH7891-01 15 nmol

KIN siRNA (Human)

Sign In for Pricing
View Details
KIN siRNA (Human)
CRH7891-02 30 nmol

KIN siRNA (Human)

Sign In for Pricing
View Details
Daxx Rabbit mAb
MBS9467461-01 0.05 mL

Daxx Rabbit mAb

Sign In for Pricing
View Details
Daxx Rabbit mAb
MBS9467461-02 0.1 mL

Daxx Rabbit mAb

Sign In for Pricing
View Details