Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Loxl2 Rabbit Polyclonal Antibody (FITC)

Loxl2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

1110004B06Rik, 4930526G11Rik, 9430067E15Rik

UniProt

P58022

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_201582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EWSR1 AAV Vector (Human) (CMV)
19552101 1 µg

EWSR1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
RPU53271-01 50 µg

Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
RPU53271-02 100 µg

Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
RPU53271-03 1 mg

Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Rabbit Polyclonal GKAP1 Antibody [HRP]
NBP1-79017H 0.1 mL

Rabbit Polyclonal GKAP1 Antibody [HRP]

Sign In for Pricing
View Details
RGD1305207 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
38930066 1.0 µg DNA

RGD1305207 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details