Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lum Rabbit Polyclonal Antibody (Biotin)

Lum Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ld, SL, Ldc, SLRR2D

UniProt

P51885

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_032550

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRZB (frizzled-Related Protein, FRE, FRITZ, FRP-3, FRZB-1, FRZB-PEN, FRZB1, FZRB, SFRP3, SRFP3, hFIZ) (MaxLight 750) discontinued
246353-ML750 100 µL

FRZB (frizzled-Related Protein, FRE, FRITZ, FRP-3, FRZB-1, FRZB-PEN, FRZB1, FZRB, SFRP3, SRFP3, hFIZ) (MaxLight 750) discontinued

Sign In for Pricing
View Details
BTN2A1 (Butyrophilin subfamily 2 member A1) BioAssayTM ELISA Kit (Human) discontinued
354336-01 48 Tests

BTN2A1 (Butyrophilin subfamily 2 member A1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
BTN2A1 (Butyrophilin subfamily 2 member A1) BioAssayTM ELISA Kit (Human) discontinued
354336-02 96 Tests

BTN2A1 (Butyrophilin subfamily 2 member A1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
ZNF749 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-20400R-BF555 100 µL

ZNF749 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
TRNAE31P ORF Vector (Human) (pORF)
ORF034667 1.0 µg DNA

TRNAE31P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CECR5, ID (Cat Eye Syndrome Critical Region Protein 5) (AP)
MBS6468555-01 0.2 mL

CECR5, ID (Cat Eye Syndrome Critical Region Protein 5) (AP)

Sign In for Pricing
View Details