Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lyn Rabbit Polyclonal Antibody (FITC)

Lyn Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hck-2, p53Lyn, p56Lyn, AA407514

UniProt

Q8CEI0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034877

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Tryptophan 5-hydroxylase 1 (TPH1) ELISA Kit
MBS7219640-01 48 Well

Bovine Tryptophan 5-hydroxylase 1 (TPH1) ELISA Kit

Sign In for Pricing
View Details
Bovine Tryptophan 5-hydroxylase 1 (TPH1) ELISA Kit
MBS7219640-02 96 Well

Bovine Tryptophan 5-hydroxylase 1 (TPH1) ELISA Kit

Sign In for Pricing
View Details
Bovine Tryptophan 5-hydroxylase 1 (TPH1) ELISA Kit
MBS7219640-03 5x 96 Well

Bovine Tryptophan 5-hydroxylase 1 (TPH1) ELISA Kit

Sign In for Pricing
View Details
Bovine Tryptophan 5-hydroxylase 1 (TPH1) ELISA Kit
MBS7219640-04 10x 96 Well

Bovine Tryptophan 5-hydroxylase 1 (TPH1) ELISA Kit

Sign In for Pricing
View Details
FGFR, phosphorylated (pY653/654) (FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR, Fibroblast growth factor receptor 1, Basic fibroblast growth factor receptor 1, Fms-like tyrosine kinase 2, N-sam, Proto-oncogene c-Fgr, CD331) (MaxLight 405) discontinued
035630-ML405 100 µL

FGFR, phosphorylated (pY653/654) (FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR, Fibroblast growth factor receptor 1, Basic fibroblast growth factor receptor 1, Fms-like tyrosine kinase 2, N-sam, Proto-oncogene c-Fgr, CD331) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Collagen III (AB1755) Rabbit mAb
M3106-01 20 µL

Collagen III (AB1755) Rabbit mAb

Sign In for Pricing
View Details