Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lyn Rabbit Polyclonal Antibody (HRP)

Lyn Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hck-2, p53Lyn, p56Lyn, AA407514

UniProt

Q8CEI0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034877

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ilf3 (NM_001042708) Mouse Untagged Clone
MC220989 10 µg

Ilf3 (NM_001042708) Mouse Untagged Clone

Sign In for Pricing
View Details
Bovine Chemokine (C-C motif) ligand 24 ELISA kit
GTR10361749 96 Well

Bovine Chemokine (C-C motif) ligand 24 ELISA kit

Sign In for Pricing
View Details
Anti-Tafazzin/TAZ Antibody Picoband®
PA2135 100 µg/Vial

Anti-Tafazzin/TAZ Antibody Picoband®

Sign In for Pricing
View Details
OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (AP)
MBS6163080-01 0.1 mL

OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (AP)

Sign In for Pricing
View Details
OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (AP)
MBS6163080-02 5x 0.1 mL

OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (AP)

Sign In for Pricing
View Details
S100 Calcium Binding Protein A5 (S100A5) Polyclonal Antibody
CAU24831-01 100 µL

S100 Calcium Binding Protein A5 (S100A5) Polyclonal Antibody

Sign In for Pricing
View Details