Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP2 Rabbit Polyclonal Antibody (HRP)

GBP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P32456

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GBP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004111

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Replacement Canister for Shipping Dewar
M-CP-111-008 1 Unit

Replacement Canister for Shipping Dewar

Sign In for Pricing
View Details
Monoclonal Antibody to Forkhead Box Protein P1 (FOXP1)
TRV-0034602-01 20 µL

Monoclonal Antibody to Forkhead Box Protein P1 (FOXP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Forkhead Box Protein P1 (FOXP1)
TRV-0034602-02 100 µL

Monoclonal Antibody to Forkhead Box Protein P1 (FOXP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Forkhead Box Protein P1 (FOXP1)
TRV-0034602-03 200 µL

Monoclonal Antibody to Forkhead Box Protein P1 (FOXP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Forkhead Box Protein P1 (FOXP1)
TRV-0034602-04 1 mL

Monoclonal Antibody to Forkhead Box Protein P1 (FOXP1)

Sign In for Pricing
View Details
Nalgene CA MF75 250ml 0.45um Filter Unit
FIL8044 12 / PCK

Nalgene CA MF75 250ml 0.45um Filter Unit

Sign In for Pricing
View Details