Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gdf10 Rabbit Polyclonal Antibody (Biotin)

Gdf10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Bmp3, Bmp3b

UniProt

P59672

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RYDPFPAGDFEPGAAPNSSADPRVRRAAQVSKPLQDNELPGLDERPAPAL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_852078

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LETMD1 Antibody
CSB-PA012879KA01HU-100ul 100 µL

LETMD1 Antibody

Sign In for Pricing
View Details
CYTSA, NT (SPECC1L, CYTSA, KIAA0376, Cytospin-A, Renal carcinoma antigen NY-REN-22, Sperm antigen with calponin homology and coiled-coil domains 1-like) (MaxLight 750) discontinued
034448-ML750 100 µL

CYTSA, NT (SPECC1L, CYTSA, KIAA0376, Cytospin-A, Renal carcinoma antigen NY-REN-22, Sperm antigen with calponin homology and coiled-coil domains 1-like) (MaxLight 750) discontinued

Sign In for Pricing
View Details
LIN7B Recombinant Protein (Rat)
RP208229 100 µg

LIN7B Recombinant Protein (Rat)

Sign In for Pricing
View Details
Anti-KLHL36 Polyclonal Antibody
TMAB-08112-01 50 μL

Anti-KLHL36 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KLHL36 Polyclonal Antibody
TMAB-08112-02 100 µL

Anti-KLHL36 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KLHL36 Polyclonal Antibody
TMAB-08112-03 200 µL

Anti-KLHL36 Polyclonal Antibody

Sign In for Pricing
View Details