Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1J Rabbit Polyclonal Antibody (Biotin)

PPM1J Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PP2CZ, PPP2CZ, PP2Czeta, PP2C-zeta

UniProt

Q5JR12

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPM1J

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitrophenyl ß-D-Galactopyranoside
BUP19543 1 g

4-Nitrophenyl ß-D-Galactopyranoside

Sign In for Pricing
View Details
OPCA01000-100UG - Recombinant human Vinculin
OPCA01000-100UG 100 µg

OPCA01000-100UG - Recombinant human Vinculin

Sign In for Pricing
View Details
Rat Tcp10b Pre-designed siRNA Set A
SI214321A 1 Each

Rat Tcp10b Pre-designed siRNA Set A

Sign In for Pricing
View Details
PRDM14 (PR Domain Zinc Finger Protein 14, PR Domain-containing Protein 14)
MBS629000-01 0.1 mg

PRDM14 (PR Domain Zinc Finger Protein 14, PR Domain-containing Protein 14)

Sign In for Pricing
View Details
PRDM14 (PR Domain Zinc Finger Protein 14, PR Domain-containing Protein 14)
MBS629000-02 5x 0.1 mg

PRDM14 (PR Domain Zinc Finger Protein 14, PR Domain-containing Protein 14)

Sign In for Pricing
View Details
ACTR6 sgRNA CRISPR Lentivector (Human) (Target 1)
K0038902 1.0 µg DNA

ACTR6 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details