Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1J Rabbit Polyclonal Antibody (FITC)

PPM1J Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PP2CZ, PPP2CZ, PP2Czeta, PP2C-zeta

UniProt

Q5JR12

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPM1J

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PDCD6IP Protein, N-GST
orb2835056-01 20 µg

Recombinant Human PDCD6IP Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human PDCD6IP Protein, N-GST
orb2835056-02 50 µg

Recombinant Human PDCD6IP Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human PDCD6IP Protein, N-GST
orb2835056-03 100 µg

Recombinant Human PDCD6IP Protein, N-GST

Sign In for Pricing
View Details
Anti-CD163 Rabbit pAb
GB11340-1-50 50 μL

Anti-CD163 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Rassf10 shRNA (UAS) - Lentiviral mouse Rassf10 shRNA (UAS, RFP) plasmid
GTR15254125 1 Vial

Lentiviral mouse Rassf10 shRNA (UAS) - Lentiviral mouse Rassf10 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
EMG1 Rabbit Polyclonal Antibody (PE)
orb493627 100 µL

EMG1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details